People Search
Phones, Emails, Addresses, Background check, Web references
All public info
Like other search engines (Google or Bing) Radaris collects information from public sources.
Dr. G. P. S. Raghava Bioinformatic Centre IMTECH, INDIA ... Of A Soluble Single-Domain Antibody With Hydrophobic Residues Typical Of A Vl ...
[email protected]: 19/08/1977 2007;TN Andhra Pradesh 33 Years: 19: Ms. V Lalithalakshmi Id No. 042400 01/09/2008;RR [email protected]: 25/11/1978
... 034 Identities = 28/94 (29%), Positives = 46/94 (48%), Gaps = 3/94 (3%) Query: 25 GMTLLEVIIVLGIMGVVSAGVVTLAQRAIDSQIMTKAAQSLNSIQVALTQTYRGLGNYPA 84 G T++E++ VL ...
p.of vl.raghava raju : p.of p.subba rao : p.of kasiraju seetharamaraju : p.of p.ramabhadra raju : 60/c2/2007-2008/2 : 8952 : 30015p/114/vlt : 16 : 2 : gandikota venkateswara rao s/o. ramulu
Venkata Raghava Nursing Home Chilakaluripeta, Guntur - 522616 ... Search By Company Name: VA VB VC VD VE VF VG VH VI VJ VK VL VM VN VO VP VQ VR VS VT ...
p.of vl.raghava raju : p.of p.subba rao : p.of kasiraju seetharamaraju : p.of p.ramabhadra raju : 60/c2/2007-2008/2 : 8952 : 30015p/114/vlt : 16 : 2 : gandikota venkateswara rao s/o. ramulu
Chief Pandit (Tamil) :M.R.Ry. Pandit M. Raghava Aiyangar Avl., from 1-2-1913. Sanskrit and Tamil pandit:- M.R.Ry. Pandit V.M. Gopalakrishnamachariar Avl., from 14-8-1915
Dr. G. P. S. Raghava Bioinformatic Centre IMTECH, INDIA ... Soluble Single-Domain Antibody With Hydrophobic Residues Typical Of A Vl ...
India - --View Raghava Vl's professional profile on LinkedIn. LinkedIn is the world's largest business network, helping professionals like Raghava Vl discover inside ...
... Prakasha Vl · Prasad Vl · Prashanthi Vl · Praveen Kumar Vl · Praveen Vl ...
Linkedin